General Information

  • ID:  hor002994
  • Uniprot ID:  P16860
  • Protein name:  BNP(2-31)
  • Gene name:  NPPB
  • Organism:  Homo sapiens (Human)
  • Family:  Natriuretic peptide family
  • Source:  Human
  • Expression:  [Brain natriuretic peptide 32]: Detected in the cardiac atria (at protein level) .
  • Disease:  Diseases associated with NPPB include Heart Valve Disease and Hypertensive Heart Disease.
  • Comments:  NA
  • Taxonomy:  Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005102 signaling receptor binding; GO:0005179 hormone activity; GO:0005515 protein binding; GO:0008613 diuretic hormone activity; GO:0051427 hormone receptor binding
  • GO BP:  GO:0003008 system process; GO:0003085 negative regulation of systemic arterial blood pressure; GO:0003161 cardiac conduction system development; GO:0006182 cGMP biosynthetic process; GO:0006457 protein folding; GO:0007166 cell surface receptor signaling pathway; GO:0007168 receptor guanylyl cyclase signaling pathway; GO:0007218 neuropeptide signaling pathway; GO:0007589 body fluid secretion; GO:0008217 regulation of blood pressure; GO:0016525 negative regulation of angiogenesis; GO:0019934 cGMP-mediated signaling; GO:0030308 negative regulation of cell growth; GO:0035810 positive regulation of urine volume; GO:0035815 positive regulation of renal sodium excretion; GO:0042311 vasodilation; GO:0043114 regulation of vascular permeability; GO:0097746 blood vessel diameter maintenance
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0005737 cytoplasm; GO:0032991 protein-containing complex

Sequence Information

  • Sequence:  PKMVQGSGCFGRKMDRISSSSGLGCKVLRR
  • Length:  30
  • Propeptide:  MDPQTAPSRALLLLLFLHLAFLGGRSHPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPRSPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH
  • Signal peptide:  MDPQTAPSRALLLLLFLHLAFLGGRS
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  2-2T->A: Prevents O-glycosylation at this residue. Decreased extracellular levels of NPPB due to decreased stability after secretion whereas extracellular levels of brain natriuretic peptide 32 is increased. In HEK293 cells, proteolytic processing by CORI

Activity

  • Function:  May function as a paracrine antifibrotic factor in the heart. Also plays a key role in cardiovascular homeostasis through natriuresis, diuresis, vasorelaxation, and inhibition of renin and aldosterone secretion.
  • Mechanism:  Plasma levels of natriuretic peptides B, brain natriuretic peptide 32 and NT-proBNP are widely used for screening and diagnosis of heart failure (HF), as these markers are typically higher in patients with severe HF.
  • Cross BBB:  NA
  • Target:  NPR1, NPR3
  • Target Unid:  P16066, P17342
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  9-25
  • Structure ID:  AF-Q3ECH9-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    AF-Q3ECH9-F1.pdbhor002994_AF2.pdbhor002994_ESM.pdb

Physical Information

Mass: 375929 Formula: C134H234N46O39S4
Absent amino acids: AEHNTWY Common amino acids: GS
pI: 11.58 Basic residues: 7
Polar residues: 12 Hydrophobic residues: 6
Hydrophobicity: -40.67 Boman Index: -6981
Half-Life: >20 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: ? Aliphatic Index 58.33
Instability Index: 7083 Extinction Coefficient cystines: 125
Absorbance 280nm: 4.31

Literature

  • PubMed ID:  NA
  • Title:  NA